Home

FASTA format

a | b | c | d | e | f | g | h | i | j | k | l | m | n | o | p | q | r | s | t | u | v | w | x | y | z | 0 | 1 | 2 | 3 | 4 | 5 | 6 | 7 | 8 | 9
Click one of the letters above to advance the page to terms beginning with that letter.

FASTA formatsearch for term

sequence format that begins with a single-line description followed by lines of sequence data. This format can be used as query input when searching bioinformatic tools such as BLAST or clustal W. The description line is distinguished from the sequence data by a greater-than (">") symbol in the first column. It is recommended that all lines of text be shorter than 80 characters in length. Blank lines are not allowed in the middle of FASTA input. An example of a protein sequence in FASTA format is :
>GI|129295|sp|P01013|OVAX_CHICK GENE X PROTEIN (OVALBUMIN-RELATED)
QIKDLLVSSSTDLDTTLVLVNAIYFKGMWKTAFNAEDTREMPFHVTKQESKPVQMMCMNNSFNVATLPAEKMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKIEEKYNLTSVLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGVIEDIKHSPESEQFRADHP FLFLIKHNPTNTIVYFGRYWSP
(http://www.ornl.gov/sci/techresources/Human_Genome/posters/chromosome/ge...)